PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C011759P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 288aa    MW: 31051.2 Da    PI: 6.6416
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C011759P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.21.2e-101255445
                     S-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                     W+ e d+ + +a + ++ +   +W++Ia  ++ g+tlk++k+++ 
   MELO3C011759P1 12 WSREQDKAFENALATYPEDasdRWEKIAVDVP-GKTLKEIKDHYE 55
                     ********************************.**********96 PP

2Myb_DNA-binding414.5e-13122166347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ l++ +  ++G+g+W++I+r +   Rt+ q+ s+ qky
   MELO3C011759P1 122 AWTEDEHRLFLLGLDKYGKGDWRSISRNFVVSRTPTQVASHAQKY 166
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.445458IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.5E-6458IPR009057Homeodomain-like
SMARTSM007175.2E-9860IPR001005SANT/Myb domain
SuperFamilySSF466892.0E-111066IPR009057Homeodomain-like
CDDcd001674.37E-91258No hitNo description
PfamPF002498.9E-81255IPR001005SANT/Myb domain
PROSITE profilePS5129417.948115171IPR017930Myb domain
SuperFamilySSF466893.04E-16117172IPR009057Homeodomain-like
SMARTSM007173.3E-11119169IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-11119165IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-17120169IPR006447Myb domain, plants
PfamPF002497.0E-11122166IPR001005SANT/Myb domain
CDDcd001671.67E-9122167No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MTVDEERKSS IWSREQDKAF ENALATYPED ASDRWEKIAV DVPGKTLKEI KDHYELLVDD  60
VNQIESGFVP LPSYSFSSDG SPSHASEEGS GKKGDYHGLD NSESRFGSKA PRSDQERRKG  120
TAWTEDEHRL FLLGLDKYGK GDWRSISRNF VVSRTPTQVA SHAQKYFIRL NSMNKDRRRS  180
SIHDITSVDN GDVSAPQGPI TGEANSYGGV GGGGSTNKST KQPPQPPIGS FGVGIYGAPT  240
VGQPVGGPFV SAVGTPVAVN TPSPAHMPYS VSSLATRPSV NMSPITY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-1712741173RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818960.0LN681896.1 Cucumis melo genomic scaffold, anchoredscaffold00016.
GenBankLN7132640.0LN713264.1 Cucumis melo genomic chromosome, chr_10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008445896.10.0PREDICTED: transcription factor DIVARICATA
RefseqXP_008445897.10.0PREDICTED: transcription factor DIVARICATA
RefseqXP_008445898.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H75e-66DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0A0KV250.0A0A0A0KV25_CUCSA; Uncharacterized protein
STRINGGLYMA07G28310.11e-142(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46943358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-100MYB family protein